PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun011002
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family HD-ZIP
Protein Properties Length: 168aa    MW: 19169.3 Da    PI: 4.9632
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Vun#S45791654PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox45.51.3e-1486132349
                --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHH CS
   Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFq 49 
                k++++t+eq++ Le+ Fe ++++  e++ +LAk+lgL+ rqV +WFq
  Vun011002  86 KKRRLTSEQVQFLERNFEVENKLEPERKVQLAKELGLQPRQVAIWFQ 132
                56689*****************************************9 PP

2HD-ZIP_I/II88.58.1e-2986166283
  HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLeke 83 
                  kkrrl++eqv++LE++Fe e+kLeperKv+la+eLglqprqva+WFq    +++     kdy +Lk++yd+lk + e+L ++
    Vun011002  86 KKRRLTSEQVQFLERNFEVENKLEPERKVQLAKELGLQPRQVAIWFQTE-GKVQDEAARKDYGTLKASYDRLKGDYESLFRD 166
                  9**********************************************86.799999*******************9999775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.63E-1476132IPR009057Homeodomain-like
PROSITE profilePS5007112.98981141IPR001356Homeobox domain
SMARTSM003894.7E-883141IPR001356Homeobox domain
CDDcd000864.09E-1284132No hitNo description
Gene3DG3DSA:1.10.10.602.5E-1484132IPR009057Homeodomain-like
PfamPF000463.8E-1286132IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MAGGKLHAAS TMSLLLQNER LPCSSEVLES LWAHTSNPAS FQGSKSMVDF ENVSGGRVTD  60
RPFFQALEKE ENCDDDYEGC FHQPGKKRRL TSEQVQFLER NFEVENKLEP ERKVQLAKEL  120
GLQPRQVAIW FQTEGKVQDE AARKDYGTLK ASYDRLKGDY ESLFRDDS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014521387.11e-107PREDICTED: LOW QUALITY PROTEIN: homeobox-leucine zipper protein HAT5
TrEMBLA0A0L9VNR31e-107A0A0L9VNR3_PHAAN; Uncharacterized protein
TrEMBLA0A0S3T3401e-107A0A0S3T340_PHAAN; Uncharacterized protein
STRINGGLYMA01G04890.11e-100(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.11e-30homeobox 1